| CDS ID | Os12t0548300-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:12:22182885:22189574:1 gene:Os12g0548300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:NUCLEOSIDE DIPHOSPHATE KINASE 2, Nucleoside diphosphate kinase 2, White stripe leaf 12 description:Nucleoside diphosphate kinase, Regulation of chloroplast development and chlorophyll biosynthesis, Abiotic stress response (ABA and salinity) (Os12t0548300-01);Similar to Nucleoside diphosphate kinase (Fragment). (Os12t0548300-02);Similar to Nucleoside diphosphate kinase (Fragment). (Os12t0548300-03) |
| Sequence | ATGGACGCCATGGCCGTGCTCGCGAGGACCTCCCGCCCCGCCCCGACCCTCCTCGCCGCG |
| PEP ID | Os12t0548300-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:12:22182885:22189574:1 gene:Os12g0548300 transcript:Os12t0548300-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:NUCLEOSIDE DIPHOSPHATE KINASE 2, Nucleoside diphosphate kinase 2, White stripe leaf 12 description:Nucleoside diphosphate kinase, Regulation of chloroplast development and chlorophyll biosynthesis, Abiotic stress response (ABA and salinity) (Os12t0548300-01);Similar to Nucleoside diphosphate kinase (Fragment). (Os12t0548300-02);Similar to Nucleoside diphosphate kinase (Fragment). (Os12t0548300-03) |
| Sequence | MDAMAVLARTSRPAPTLLAATSPAVSRRPAAVSFAAAASPGSRGRVALSAAWGGRAARGR |
| Transcript ID | Os12t0548300-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:12:22182885:22189574:1 gene:Os12g0548300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:NUCLEOSIDE DIPHOSPHATE KINASE 2, Nucleoside diphosphate kinase 2, White stripe leaf 12 description:Nucleoside diphosphate kinase, Regulation of chloroplast development and chlorophyll biosynthesis, Abiotic stress response (ABA and salinity) (Os12t0548300-01);Similar to Nucleoside diphosphate kinase (Fragment). (Os12t0548300-02);Similar to Nucleoside diphosphate kinase (Fragment). (Os12t0548300-03) |
| Sequence | CTCTGCTCCTGCTCATCATCTTCTTCTTCTCCGCTCTCCCTAATCCAAAAAAAGGCGGCT |