| CDS ID | Os12t0420400-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:12:13115368:13117325:1 gene:Os12g0420400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:PHOTOSYSTEM I SUBUNIT description:Similar to Photosystem I reaction center subunit XI, chloroplast precursor (PSI- L) (PSI subunit V). (Os12t0420400-01);Similar to Photosystem I reaction center subunit XI, chloroplast precursor (PSI- L) (PSI subunit V). (Os12t0420400-02);Similar to Photosystem I reaction center subunit XI, chloroplastic. (Os12t0420400-03) |
| Sequence | ATGGCCACTGCTTATGCTCCCATGGCGAGCCAGCTGATGAAGAGCAGCTTGGTGTGCTCC |
| PEP ID | Os12t0420400-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:12:13115368:13117325:1 gene:Os12g0420400 transcript:Os12t0420400-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:PHOTOSYSTEM I SUBUNIT description:Similar to Photosystem I reaction center subunit XI, chloroplast precursor (PSI- L) (PSI subunit V). (Os12t0420400-01);Similar to Photosystem I reaction center subunit XI, chloroplast precursor (PSI- L) (PSI subunit V). (Os12t0420400-02);Similar to Photosystem I reaction center subunit XI, chloroplastic. (Os12t0420400-03) |
| Sequence | MATAYAPMASQLMKSSLVCSKPRGLSGASLTRRPRFTVKAIQSEKPTYQVVQPINGDPFI |
| Transcript ID | Os12t0420400-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:12:13115368:13117325:1 gene:Os12g0420400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:PHOTOSYSTEM I SUBUNIT description:Similar to Photosystem I reaction center subunit XI, chloroplast precursor (PSI- L) (PSI subunit V). (Os12t0420400-01);Similar to Photosystem I reaction center subunit XI, chloroplast precursor (PSI- L) (PSI subunit V). (Os12t0420400-02);Similar to Photosystem I reaction center subunit XI, chloroplastic. (Os12t0420400-03) |
| Sequence | AGTTGCCAAGAAGGCTGTTTCACATCCATTTTTTTTGGCCGGGAGAGAGAGCATCTAGCT |