| CDS ID | Os12t0292400-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:12:11320409:11322505:1 gene:Os12g0292400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:nuclear encoded small subunit of ribulose-1, 5-bisphosphate carboxylase/oxygenase, RuBisCO small subunit 4, Ribulose-1, 5-Bisphosphate Carboxylase/Oxygenase Small Subunit 4 description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0292400-01) |
| Sequence | ATGGCTCCCTCGGTGATGGCTTCGTCGGCCACCTCCGTGGCTCCCTTCCAGGGGCTCAAG |
| PEP ID | Os12t0292400-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:12:11320409:11322505:1 gene:Os12g0292400 transcript:Os12t0292400-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:nuclear encoded small subunit of ribulose-1, 5-bisphosphate carboxylase/oxygenase, RuBisCO small subunit 4, Ribulose-1, 5-Bisphosphate Carboxylase/Oxygenase Small Subunit 4 description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0292400-01) |
| Sequence | MAPSVMASSATSVAPFQGLKSTAGLPVNRRSSSSSFGNVSNGGRIRCMQVWPIEGIKKFE |
| Transcript ID | Os12t0292400-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:12:11320409:11322505:1 gene:Os12g0292400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:nuclear encoded small subunit of ribulose-1, 5-bisphosphate carboxylase/oxygenase, RuBisCO small subunit 4, Ribulose-1, 5-Bisphosphate Carboxylase/Oxygenase Small Subunit 4 description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0292400-01) |
| Sequence | GTACTCAAGCCGGAGGCAGCACACTGCAACTTAAGTTTTTCTATAGCTCCTAGCAAGCTA |