| CDS ID | Os12t0291100-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:12:11262587:11263593:1 gene:Os12g0291100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RuBisCO small subunit 3, Ribulose-1, 5-Bisphosphate Carboxylase/Oxygenase Small Subunit 3 description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0291100-01);Similar to Ribulose bisphosphate carboxylase small chain. (Os12t0291100-02);Non-protein coding transcript. (Os12t0291100-03) |
| Sequence | ATGGCCCCCACCGTGATGGCCTCCTCGGCCACCTCCGTGGCTCCATTCCAAGGGCTCAAG |
| PEP ID | Os12t0291100-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:12:11262587:11263593:1 gene:Os12g0291100 transcript:Os12t0291100-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RuBisCO small subunit 3, Ribulose-1, 5-Bisphosphate Carboxylase/Oxygenase Small Subunit 3 description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0291100-01);Similar to Ribulose bisphosphate carboxylase small chain. (Os12t0291100-02);Non-protein coding transcript. (Os12t0291100-03) |
| Sequence | MAPTVMASSATSVAPFQGLKSTAGLPVSRRSTNSGFGNVSNGGRIKCMQVWPIEGIKKFE |
| Transcript ID | Os12t0291100-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:12:11262587:11263593:1 gene:Os12g0291100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RuBisCO small subunit 3, Ribulose-1, 5-Bisphosphate Carboxylase/Oxygenase Small Subunit 3 description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0291100-01);Similar to Ribulose bisphosphate carboxylase small chain. (Os12t0291100-02);Non-protein coding transcript. (Os12t0291100-03) |
| Sequence | AACAGCACTGCTACTGGACATACTCTACTACTACTAGCCAGTAAGCTAGCTAACTAACTA |