| CDS ID | Os12t0277500-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:12:10293602:10297901:1 gene:Os12g0277500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:chaperonin 60 alpha subunit 1 description:Plastid chaperonin 60 alpha subunit, Folding of Rubisco large subunit (rbcL), Seedling development (Os12t0277500-01);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-02);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-03);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-04) |
| Sequence | ATGGCGTCCGCCAACGCCATCTCCACCGCCTCCCTCCTCCGCTCTTTCTCCTCCCAGGGG |
| PEP ID | Os12t0277500-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:12:10293602:10297901:1 gene:Os12g0277500 transcript:Os12t0277500-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:chaperonin 60 alpha subunit 1 description:Plastid chaperonin 60 alpha subunit, Folding of Rubisco large subunit (rbcL), Seedling development (Os12t0277500-01);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-02);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-03);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-04) |
| Sequence | MASANAISTASLLRSFSSQGRVRRAKNGRAQRLVVRADAKDIAFDQKSRAALQAGVEKLA |
| Transcript ID | Os12t0277500-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:12:10293602:10297901:1 gene:Os12g0277500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:chaperonin 60 alpha subunit 1 description:Plastid chaperonin 60 alpha subunit, Folding of Rubisco large subunit (rbcL), Seedling development (Os12t0277500-01);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-02);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-03);Similar to RuBisCO large subunit-binding protein subunit alpha, chloroplastic (Fragment). (Os12t0277500-04) |
| Sequence | ACTCTTCCGCCCCCAAATCCTCCTGCTCACCTCACCTTATCCTCAGCTCTCAGCACCTCT |