| CDS ID | Os12t0274700-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:12:10080508:10081440:-1 gene:Os12g0274700 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RUBISCO SMALL SUBUNIT description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0274700-01);Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0274700-02) |
| Sequence | ATGGCCCCCTCCGTGATGGCGTCGTCGGCCACCACCGTCGCTCCCTTCCAGGGGCTCAAG |
| PEP ID | Os12t0274700-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:12:10080508:10081440:-1 gene:Os12g0274700 transcript:Os12t0274700-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RUBISCO SMALL SUBUNIT description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0274700-01);Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0274700-02) |
| Sequence | MAPSVMASSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFE |
| Transcript ID | Os12t0274700-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:12:10080508:10081440:-1 gene:Os12g0274700 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RUBISCO SMALL SUBUNIT description:Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0274700-01);Similar to Petunia ribulose 1,5-bisphosphate carboxylase small subunit mRNA (clone pSSU 51), partial cds. (Fragment). (Os12t0274700-02) |
| Sequence | AGCAGTGCATCTCAAGAAGTACTCGAGCAAAGAAGGAGAGAGCTTGGTGAGCTGCAGAGA |