| CDS ID | Os12t0197500-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:12:5035974:5040878:-1 gene:Os12g0197500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:suppressor of gene silencing 3 description:Homolog of Arabidopsis suppressor of gene silencing 3, Cofactor of RNA-dependent RNA polymerase, Defense response to virus (Os12t0197500-01);Similar to Protein SUPPRESSOR OF GENE SILENCING 3 homolog. (Os12t0197500-02);Similar to Protein SUPPRESSOR OF GENE SILENCING 3 homolog. (Os12t0197500-03) |
| Sequence | ATGGCGTCCGCCGGCGATCGCCGCGGCGGCGGGGGGCCTCCCGGCTCCGGCGACGACTCC |
| PEP ID | Os12t0197500-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:12:5035974:5040878:-1 gene:Os12g0197500 transcript:Os12t0197500-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:suppressor of gene silencing 3 description:Homolog of Arabidopsis suppressor of gene silencing 3, Cofactor of RNA-dependent RNA polymerase, Defense response to virus (Os12t0197500-01);Similar to Protein SUPPRESSOR OF GENE SILENCING 3 homolog. (Os12t0197500-02);Similar to Protein SUPPRESSOR OF GENE SILENCING 3 homolog. (Os12t0197500-03) |
| Sequence | MASAGDRRGGGGPPGSGDDSGGGWETVEKRVKKPAQQVGKGQWGQWNSPNAAPAPTAPRS |
| Transcript ID | Os12t0197500-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:12:5035974:5040878:-1 gene:Os12g0197500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:suppressor of gene silencing 3 description:Homolog of Arabidopsis suppressor of gene silencing 3, Cofactor of RNA-dependent RNA polymerase, Defense response to virus (Os12t0197500-01);Similar to Protein SUPPRESSOR OF GENE SILENCING 3 homolog. (Os12t0197500-02);Similar to Protein SUPPRESSOR OF GENE SILENCING 3 homolog. (Os12t0197500-03) |
| Sequence | TCTCTCTCTCTCTCTCTCTCTCTCCTCGAAAACCCCAACACACACAACGCGAACCCCACT |