| CDS ID | Os11t0267000-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:11:9177495:9178565:1 gene:Os11g0267000 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Genome uncoupled 4, magnesium chelatase (Mg-chelatase) activating factor, magnesium chelatase accessory protein GUN4, magnesium-chelatase accessory protein GUN4 description:Regulator of the Magnesium-chelatase subunit ChlH activity, Activation of the ChlH subunit of magnesium chelatase, Chlorophyll synthesis (Os11t0267000-02);GUN4-like domain containing protein. (Os11t0267000-03) |
| Sequence | ATGGCAAATGCTTCCCTCCAATCCTTTCTTCTTCACCACCACCATTCTTTCCTTAGCAAT |
| PEP ID | Os11t0267000-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:11:9177495:9178565:1 gene:Os11g0267000 transcript:Os11t0267000-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Genome uncoupled 4, magnesium chelatase (Mg-chelatase) activating factor, magnesium chelatase accessory protein GUN4, magnesium-chelatase accessory protein GUN4 description:Regulator of the Magnesium-chelatase subunit ChlH activity, Activation of the ChlH subunit of magnesium chelatase, Chlorophyll synthesis (Os11t0267000-02);GUN4-like domain containing protein. (Os11t0267000-03) |
| Sequence | MANASLQSFLLHHHHSFLSNGIHEGSSPSIILKLTTNSNSSISFKLFSNTTSSSSSSVTT |
| Transcript ID | Os11t0267000-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:11:9177495:9178565:1 gene:Os11g0267000 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Genome uncoupled 4, magnesium chelatase (Mg-chelatase) activating factor, magnesium chelatase accessory protein GUN4, magnesium-chelatase accessory protein GUN4 description:Regulator of the Magnesium-chelatase subunit ChlH activity, Activation of the ChlH subunit of magnesium chelatase, Chlorophyll synthesis (Os11t0267000-02);GUN4-like domain containing protein. (Os11t0267000-03) |
| Sequence | CTCATTTCCATTTCCAGTTGCAGCAAGAGCTGCCTCCTAGCTCTCTTCCTGCCATCCATG |