| CDS ID | Os10t0456800-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:10:16705515:16708492:-1 gene:Os10g0456800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DST Co-activator 1 description:CHY zinc finger protein, Transcriptional co-activator of DST (Drought and Salt Tolerance: zinc finger transcription factor gene), Drought and salt tolerance, Stomatal aperture control (Os10t0456800-01);Similar to CHY zinc finger family protein, expressed. (Os10t0456800-02) |
| Sequence | ATGGAATTGGAGTCGGAGCAGCACGGCTGCGAGCATTACACGAGGGGATGCAGGATCAGG |
| PEP ID | Os10t0456800-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:10:16705515:16708492:-1 gene:Os10g0456800 transcript:Os10t0456800-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DST Co-activator 1 description:CHY zinc finger protein, Transcriptional co-activator of DST (Drought and Salt Tolerance: zinc finger transcription factor gene), Drought and salt tolerance, Stomatal aperture control (Os10t0456800-01);Similar to CHY zinc finger family protein, expressed. (Os10t0456800-02) |
| Sequence | MELESEQHGCEHYTRGCRIRAPCCGEVFGCRHCHNEAKNSLEIHLNDRHEIPRHEIKKVI |
| Transcript ID | Os10t0456800-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:10:16705515:16708492:-1 gene:Os10g0456800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DST Co-activator 1 description:CHY zinc finger protein, Transcriptional co-activator of DST (Drought and Salt Tolerance: zinc finger transcription factor gene), Drought and salt tolerance, Stomatal aperture control (Os10t0456800-01);Similar to CHY zinc finger family protein, expressed. (Os10t0456800-02) |
| Sequence | CTCCTTCCCTCCCGCCGTTGCCAACCACCCCCTTCCCCTCCCCCCTCGCCCTCGCCGCCG |