| CDS ID | Os10t0409400-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:10:14171332:14172873:-1 gene:Os10g0409400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:polygalacturonase isoenzyme 1 beta subunit, BURP domain-containing protein 16, beta subunit of polygalacturonase 1, polygalacturonase 1 beta subunit, non-catalytic PG1beta subunit description:beta subunit of polygalacturonase 1, Abiotic stress response (Os10t0409400-01) |
| Sequence | ATGGCAACATCCTTTCTCTTCTCTCTCATTCTCCTCCTCATCACTGCCCTTTCTCTTCCC |
| PEP ID | Os10t0409400-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:10:14171332:14172873:-1 gene:Os10g0409400 transcript:Os10t0409400-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:polygalacturonase isoenzyme 1 beta subunit, BURP domain-containing protein 16, beta subunit of polygalacturonase 1, polygalacturonase 1 beta subunit, non-catalytic PG1beta subunit description:beta subunit of polygalacturonase 1, Abiotic stress response (Os10t0409400-01) |
| Sequence | MATSFLFSLILLLITALSLPFPLHASSVDPLSAGATTVRYWNRKIPNNAPHPDFFLSLLS |
| Transcript ID | Os10t0409400-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:10:14171332:14172873:-1 gene:Os10g0409400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:polygalacturonase isoenzyme 1 beta subunit, BURP domain-containing protein 16, beta subunit of polygalacturonase 1, polygalacturonase 1 beta subunit, non-catalytic PG1beta subunit description:beta subunit of polygalacturonase 1, Abiotic stress response (Os10t0409400-01) |
| Sequence | ACTTGTCTTTCCAGCACAGCTAGCATTCTACCAACCAATGGCAACATCCTTTCTCTTCTC |