| CDS ID | Os10t0127900-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:10:1743605:1746986:-1 gene:Os10g0127900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F-box gene 352, F-box domain protein 352, F-box protein 516 description:Similar to F-box domain containing protein, expressed. (Os10t0127900-01);Similar to F-box domain containing protein, expressed. (Os10t0127900-02);Similar to F-box domain containing protein, expressed. (Os10t0127900-03) |
| Sequence | ATGCCACCGCGCGCTCTGCCCCCAGTGGAGGACGACGCCGGCAGGGACTGGCTCGGTGAC |
| PEP ID | Os10t0127900-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:10:1743605:1746986:-1 gene:Os10g0127900 transcript:Os10t0127900-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F-box gene 352, F-box domain protein 352, F-box protein 516 description:Similar to F-box domain containing protein, expressed. (Os10t0127900-01);Similar to F-box domain containing protein, expressed. (Os10t0127900-02);Similar to F-box domain containing protein, expressed. (Os10t0127900-03) |
| Sequence | MPPRALPPVEDDAGRDWLGDLPEEVLHHIMSFLDARQAVRTCVLSRRWRNLWRTVPCINA |
| Transcript ID | Os10t0127900-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:10:1743605:1746986:-1 gene:Os10g0127900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F-box gene 352, F-box domain protein 352, F-box protein 516 description:Similar to F-box domain containing protein, expressed. (Os10t0127900-01);Similar to F-box domain containing protein, expressed. (Os10t0127900-02);Similar to F-box domain containing protein, expressed. (Os10t0127900-03) |
| Sequence | GTATTACTCCTTGTCACGGACAGTTTGAGAGCGGGAGGCCTCCTCCCAATCTCCCCCCTT |