| CDS ID | Os09t0526600-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:9:20593307:20594901:-1 gene:Os09g0526600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:HEAT STRESS TRANSCRIPTION FACTOR B2C description:Similar to Isoform 2 of Heat stress transcription factor B-2c. (Os09t0526600-01);Similar to Heat shock factor protein 3 (HSF 3) (Heat shock transcription factor 3) (HSTF 3). (Os09t0526600-02);Similar to Isoform 2 of Heat stress transcription factor B-2c. (Os09t0526600-03) |
| Sequence | AAGACGTACCAGCTGGTGGAGGACCCGGCGGTGGACGACGTGATCTCGTGGAACGAGGAC |
| PEP ID | Os09t0526600-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:9:20593307:20594901:-1 gene:Os09g0526600 transcript:Os09t0526600-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:HEAT STRESS TRANSCRIPTION FACTOR B2C description:Similar to Isoform 2 of Heat stress transcription factor B-2c. (Os09t0526600-01);Similar to Heat shock factor protein 3 (HSF 3) (Heat shock transcription factor 3) (HSTF 3). (Os09t0526600-02);Similar to Isoform 2 of Heat stress transcription factor B-2c. (Os09t0526600-03) |
| Sequence | KTYQLVEDPAVDDVISWNEDGSTFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYGFRK |
| Transcript ID | Os09t0526600-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:9:20593307:20594901:-1 gene:Os09g0526600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:HEAT STRESS TRANSCRIPTION FACTOR B2C description:Similar to Isoform 2 of Heat stress transcription factor B-2c. (Os09t0526600-01);Similar to Heat shock factor protein 3 (HSF 3) (Heat shock transcription factor 3) (HSTF 3). (Os09t0526600-02);Similar to Isoform 2 of Heat stress transcription factor B-2c. (Os09t0526600-03) |
| Sequence | CGAAGACGTACCAGCTGGTGGAGGACCCGGCGGTGGACGACGTGATCTCGTGGAACGAGG |