| CDS ID | Os09t0502100-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:9:19425079:19430998:-1 gene:Os09g0502100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LAGGING GROWTH AND DEVELOPMENT 1 description:Von Willebrand factor type A (VWA) domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-01);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-02);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-03);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-04);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-05);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-06) |
| Sequence | ATGGAGGGGGAGGAGGGGAGGAAGGGGAAGGAGGCACTGAGCGGGGGGCACCTCTGCCAC |
| PEP ID | Os09t0502100-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:9:19425079:19430998:-1 gene:Os09g0502100 transcript:Os09t0502100-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LAGGING GROWTH AND DEVELOPMENT 1 description:Von Willebrand factor type A (VWA) domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-01);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-02);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-03);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-04);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-05);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-06) |
| Sequence | MEGEEGRKGKEALSGGHLCHVCGYQYPNANPSAKLRRSHRKNCGKAPAADEREEGEEVDA |
| Transcript ID | Os09t0502100-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:9:19425079:19430998:-1 gene:Os09g0502100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LAGGING GROWTH AND DEVELOPMENT 1 description:Von Willebrand factor type A (VWA) domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-01);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-02);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-03);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-04);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-05);VWA domain containing protein, RNA binding protein, Regulation of vegetative growth and development (Os09t0502100-06) |
| Sequence | AAGGAGGAGGAGTTTAGTAGTAACCTCTTTCTTCTTCCATCCATCGCCGCCGCCGCCGCC |