| CDS ID | Os09t0482600-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:9:18537088:18541201:-1 gene:Os09g0482600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rice 90kDa heat shock protein, heat-shock protein 90, heat-shock protein 82, heat shock protein 82, heat-shock protein 86 description:Similar to Heat shock protein 81-3. (Os09t0482600-01);Similar to Heat shock protein 81-3. (Os09t0482600-02) |
| Sequence | ATGGCGTCGGAGACCGAGACGTTCGCCTTCCAGGCCGAGATCAACCAGCTGCTGTCCCTC |
| PEP ID | Os09t0482600-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:9:18537088:18541201:-1 gene:Os09g0482600 transcript:Os09t0482600-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rice 90kDa heat shock protein, heat-shock protein 90, heat-shock protein 82, heat shock protein 82, heat-shock protein 86 description:Similar to Heat shock protein 81-3. (Os09t0482600-01);Similar to Heat shock protein 81-3. (Os09t0482600-02) |
| Sequence | MASETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDA |
| Transcript ID | Os09t0482600-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:9:18537088:18541201:-1 gene:Os09g0482600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rice 90kDa heat shock protein, heat-shock protein 90, heat-shock protein 82, heat shock protein 82, heat-shock protein 86 description:Similar to Heat shock protein 81-3. (Os09t0482600-01);Similar to Heat shock protein 81-3. (Os09t0482600-02) |
| Sequence | CTCTTGGAAACCCCTCCAAACCCTAGCCGCCTCTCGTTTCTTCTCGTCCTCTCCACGCCC |