| CDS ID | Os09t0114500-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:9:1162886:1167363:1 gene:Os09g0114500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BRITTLE CULM 12 description:Kinesin-4 protein with transcription regulation activity, Cell cycle and wall modification, Cell elongation by regulating GA biosynthesis pathway (Os09t0114500-01);Similar to Kinesin-like protein. (Os09t0114500-02);Similar to FRA1 (FRAGILE FIBER 1); microtubule motor. (Os09t0114500-03);Hypothetical protein. (Os09t0114500-04) |
| Sequence | GGTGAAGGGCTCAAAAGAAGCTTGCAAAGTACAGAACCATTTGATGTCCCCATGACTGAC |
| PEP ID | Os09t0114500-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:9:1162886:1167363:1 gene:Os09g0114500 transcript:Os09t0114500-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BRITTLE CULM 12 description:Kinesin-4 protein with transcription regulation activity, Cell cycle and wall modification, Cell elongation by regulating GA biosynthesis pathway (Os09t0114500-01);Similar to Kinesin-like protein. (Os09t0114500-02);Similar to FRA1 (FRAGILE FIBER 1); microtubule motor. (Os09t0114500-03);Hypothetical protein. (Os09t0114500-04) |
| Sequence | GEGLKRSLQSTEPFDVPMTDSVRGSPKDIDDEVAKEWEHTMLQDSMGKELNELNRQLEQK |
| Transcript ID | Os09t0114500-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:9:1162886:1167363:1 gene:Os09g0114500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BRITTLE CULM 12 description:Kinesin-4 protein with transcription regulation activity, Cell cycle and wall modification, Cell elongation by regulating GA biosynthesis pathway (Os09t0114500-01);Similar to Kinesin-like protein. (Os09t0114500-02);Similar to FRA1 (FRAGILE FIBER 1); microtubule motor. (Os09t0114500-03);Hypothetical protein. (Os09t0114500-04) |
| Sequence | AAGGTGAAGGGCTCAAAAGAAGCTTGCAAAGTACAGAACCATTTGATGTCCCCATGACTG |