| CDS ID | Os08t0560900-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:8:28083386:28084216:-1 gene:Os08g0560900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:PHOTOSYSTEM I SUBUNIT description:Similar to Photosystem I reaction center subunit II, chloroplast precursor (Photosystem I 20 kDa subunit) (PSI-D). (Os08t0560900-01);Similar to Photosystem I reaction center subunit II, chloroplast precursor (Photosystem I 20 kDa subunit) (PSI-D). (Os08t0560900-02);Similar to Photosystem I reaction center subunit II, chloroplastic. (Os08t0560900-03) |
| Sequence | ATGGCCATGGCCACGCAAGCCTCCGCCGCCAAGTGCCACCTCCTCGCCGCCTGGGCACCG |
| PEP ID | Os08t0560900-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:8:28083386:28084216:-1 gene:Os08g0560900 transcript:Os08t0560900-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:PHOTOSYSTEM I SUBUNIT description:Similar to Photosystem I reaction center subunit II, chloroplast precursor (Photosystem I 20 kDa subunit) (PSI-D). (Os08t0560900-01);Similar to Photosystem I reaction center subunit II, chloroplast precursor (Photosystem I 20 kDa subunit) (PSI-D). (Os08t0560900-02);Similar to Photosystem I reaction center subunit II, chloroplastic. (Os08t0560900-03) |
| Sequence | MAMATQASAAKCHLLAAWAPAKPRSSTLSMPTSRAPTSLRAAAEDQPAAAATEEKKPAPA |
| Transcript ID | Os08t0560900-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:8:28083386:28084216:-1 gene:Os08g0560900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:PHOTOSYSTEM I SUBUNIT description:Similar to Photosystem I reaction center subunit II, chloroplast precursor (Photosystem I 20 kDa subunit) (PSI-D). (Os08t0560900-01);Similar to Photosystem I reaction center subunit II, chloroplast precursor (Photosystem I 20 kDa subunit) (PSI-D). (Os08t0560900-02);Similar to Photosystem I reaction center subunit II, chloroplastic. (Os08t0560900-03) |
| Sequence | GAATCCACCACACGGTACCCTCCTCTCTCCTCCTCCGACCACCATGGCCATGGCCACGCA |