| CDS ID | Os08t0532800-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:8:26554159:26557021:-1 gene:Os08g0532800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 22, type G nsLTP 22, type G non-specific lipid transfer protein 22 description:Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor domain containing protein. (Os08t0532800-02);Similar to Lipid transfer protein. (Os08t0532800-03) |
| Sequence | ATGGCGGCGTGGCGCGGTCTGGCGTTGGCAGCGGTGGTGGCGTGGTGCGTGGCGGCGGCG |
| PEP ID | Os08t0532800-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:8:26554159:26557021:-1 gene:Os08g0532800 transcript:Os08t0532800-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 22, type G nsLTP 22, type G non-specific lipid transfer protein 22 description:Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor domain containing protein. (Os08t0532800-02);Similar to Lipid transfer protein. (Os08t0532800-03) |
| Sequence | MAAWRGLALAAVVAWCVAAAAAAPDAALQSKCQQDFTKLTDCMDYATGHEEAPSSTCCGD |
| Transcript ID | Os08t0532800-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:8:26554159:26557021:-1 gene:Os08g0532800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 22, type G nsLTP 22, type G non-specific lipid transfer protein 22 description:Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor domain containing protein. (Os08t0532800-02);Similar to Lipid transfer protein. (Os08t0532800-03) |
| Sequence | ATCGCCACCGTCGTTCACACCACACCACCTGCTGCACACAGCTCGATCGAGTTAGCCCAC |