| CDS ID | Os08t0435900-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:8:21171332:21172643:-1 gene:Os08g0435900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:chlorophyll a/b binding protein, light-harvesting chlorophyll a/b binding protein, cab gene from Norin 8 description:Similar to LHC I type IV chlorophyll binding protein (Fragment). (Os08t0435900-01);Similar to LHC I type IV chlorophyll binding protein (Fragment). (Os08t0435900-03);Non-protein coding transcript. (Os08t0435900-04) |
| Sequence | ATGGCGTCCGTCACCGCCCGCACCCCGGTCGCAGCCCTCCGCTCGTCGGCGTCGCTCAAG |
| PEP ID | Os08t0435900-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:8:21171332:21172643:-1 gene:Os08g0435900 transcript:Os08t0435900-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:chlorophyll a/b binding protein, light-harvesting chlorophyll a/b binding protein, cab gene from Norin 8 description:Similar to LHC I type IV chlorophyll binding protein (Fragment). (Os08t0435900-01);Similar to LHC I type IV chlorophyll binding protein (Fragment). (Os08t0435900-03);Non-protein coding transcript. (Os08t0435900-04) |
| Sequence | MASVTARTPVAALRSSASLKSTFLGQSSTRLARAPTTRRNVRAEAKGEWLPGLPSPTYLN |
| Transcript ID | Os08t0435900-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:8:21171332:21172643:-1 gene:Os08g0435900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:chlorophyll a/b binding protein, light-harvesting chlorophyll a/b binding protein, cab gene from Norin 8 description:Similar to LHC I type IV chlorophyll binding protein (Fragment). (Os08t0435900-01);Similar to LHC I type IV chlorophyll binding protein (Fragment). (Os08t0435900-03);Non-protein coding transcript. (Os08t0435900-04) |
| Sequence | ACCCTTGTGACTACACCCGCTTCGCTTCCTCCCCTCTCTAAGCCGGGGAAGCTAAGCCAT |