| CDS ID | Os08t0346400-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:8:15695582:15703940:1 gene:Os08g0346400 gene_biotype:protein_coding transcript_biotype:protein_coding description:Similar to Phosphate starvation regulator protein (Regulatory protein of P- starvation acclimation response Psr1). (Os08t0346400-01);Similar to Phosphate starvation regulator protein (Regulatory protein of P- starvation acclimation response Psr1). (Os08t0346400-02);Similar to myb family transcription factor-related protein. (Os08t0346400-03) |
| Sequence | ATGTTCCCCGGCCTGATCCACCACCACCGCCTCCTCGACGCCGATGTCGGCGGCGGCGGC |
| PEP ID | Os08t0346400-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:8:15695582:15703940:1 gene:Os08g0346400 transcript:Os08t0346400-02 gene_biotype:protein_coding transcript_biotype:protein_coding description:Similar to Phosphate starvation regulator protein (Regulatory protein of P- starvation acclimation response Psr1). (Os08t0346400-01);Similar to Phosphate starvation regulator protein (Regulatory protein of P- starvation acclimation response Psr1). (Os08t0346400-02);Similar to myb family transcription factor-related protein. (Os08t0346400-03) |
| Sequence | MFPGLIHHHRLLDADVGGGGGGSSAGLVLTADPKPRLRWTADLHDRFVDAVAQLGGPDKA |
| Transcript ID | Os08t0346400-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:8:15695582:15703940:1 gene:Os08g0346400 gene_biotype:protein_coding transcript_biotype:protein_coding description:Similar to Phosphate starvation regulator protein (Regulatory protein of P- starvation acclimation response Psr1). (Os08t0346400-01);Similar to Phosphate starvation regulator protein (Regulatory protein of P- starvation acclimation response Psr1). (Os08t0346400-02);Similar to myb family transcription factor-related protein. (Os08t0346400-03) |
| Sequence | AGGTTCTCGACTCTCCTCTCGTCTCGAGAGCAGCAACAGCAGCAGAAGAAGAGAAGAGCA |