| CDS ID | Os07t0691800-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:7:29435879:29437389:-1 gene:Os07g0691800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rice homolog of human 26S protease subunit 4, rice homolog of human 26S protease S4, 19S regulatory particle ATPase subunit 2a, RP triple A-ATPase 2a description:Similar to 26S proteasome subunit 4-like protein (26S proteasome subunit AtRPT2a). (Os07t0691800-01);Similar to 26S protease regulatory subunit 4 homolog. (Os07t0691800-02);Non-protein coding transcript. (Os07t0691800-03) |
| Sequence | GAAATCAAAGAGGCAGTTGAGCTTCCTTTGACCCATCCTGAGCTATATGAAGACATTGGC |
| PEP ID | Os07t0691800-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:7:29435879:29437389:-1 gene:Os07g0691800 transcript:Os07t0691800-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rice homolog of human 26S protease subunit 4, rice homolog of human 26S protease S4, 19S regulatory particle ATPase subunit 2a, RP triple A-ATPase 2a description:Similar to 26S proteasome subunit 4-like protein (26S proteasome subunit AtRPT2a). (Os07t0691800-01);Similar to 26S protease regulatory subunit 4 homolog. (Os07t0691800-02);Non-protein coding transcript. (Os07t0691800-03) |
| Sequence | EIKEAVELPLTHPELYEDIGIRPPKGVILYGEPGTGKTLLAKAVANSTSATFLRVVGSEL |
| Transcript ID | Os07t0691800-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:7:29435879:29437389:-1 gene:Os07g0691800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rice homolog of human 26S protease subunit 4, rice homolog of human 26S protease S4, 19S regulatory particle ATPase subunit 2a, RP triple A-ATPase 2a description:Similar to 26S proteasome subunit 4-like protein (26S proteasome subunit AtRPT2a). (Os07t0691800-01);Similar to 26S protease regulatory subunit 4 homolog. (Os07t0691800-02);Non-protein coding transcript. (Os07t0691800-03) |
| Sequence | AGAAATCAAAGAGGCAGTTGAGCTTCCTTTGACCCATCCTGAGCTATATGAAGACATTGG |