| CDS ID | Os07t0658300-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:7:27713321:27722641:1 gene:Os07g0658300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SPL11-interacting Protein 6, SPL11-interacting protein6 description:Rho GTPase-activating protein, Target of the E3 ligase SPL11, Negative regulation of programmed cell death and innate immunity (Os07t0658300-01);Splicing isoform of SPIN6 (Os07t0658300-02);Splicing isoform of SPIN6 (Os07t0658300-03) |
| Sequence | ATGGCTGCGGCGACGGCGCCGGTGGCGGGTGCGGCGGAGCGGCAGCAGCAACAGCAGCAG |
| PEP ID | Os07t0658300-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:7:27713321:27722641:1 gene:Os07g0658300 transcript:Os07t0658300-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SPL11-interacting Protein 6, SPL11-interacting protein6 description:Rho GTPase-activating protein, Target of the E3 ligase SPL11, Negative regulation of programmed cell death and innate immunity (Os07t0658300-01);Splicing isoform of SPIN6 (Os07t0658300-02);Splicing isoform of SPIN6 (Os07t0658300-03) |
| Sequence | MAAATAPVAGAAERQQQQQQQQRGGAASASGNAVFKSGPLFISSKGIGWKSWKKRWFILT |
| Transcript ID | Os07t0658300-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:7:27713321:27722641:1 gene:Os07g0658300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SPL11-interacting Protein 6, SPL11-interacting protein6 description:Rho GTPase-activating protein, Target of the E3 ligase SPL11, Negative regulation of programmed cell death and innate immunity (Os07t0658300-01);Splicing isoform of SPIN6 (Os07t0658300-02);Splicing isoform of SPIN6 (Os07t0658300-03) |
| Sequence | ACGCGCCCACGCCCACCACCACCACCACCTCCATGACTGCATCCTCCTCCAAAAACCCAA |