| CDS ID | Os07t0555200-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:7:22114961:22120060:1 gene:Os07g0555200 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Rice tungro spherical virus (RTSV) resistance gene, RTSV resistance gene, eukaryotic translation initiation factor 4G description:Similar to Eukaryotic translation initiation factor 4g (Fragment). (Os07t0555200-01);Similar to Eukaryotic translation initiation factor 4g (Fragment). (Os07t0555200-02);Similar to predicted protein. (Os07t0555200-03);Similar to predicted protein. (Os07t0555200-04);Similar to predicted protein. (Os07t0555200-05) |
| Sequence | ATGTCCCAGCGAGGGGACAGGGGCGAGGGGCACGCGAGGAGACCCGGCCGGTCCAGCAGC |
| PEP ID | Os07t0555200-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:7:22114961:22120060:1 gene:Os07g0555200 transcript:Os07t0555200-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Rice tungro spherical virus (RTSV) resistance gene, RTSV resistance gene, eukaryotic translation initiation factor 4G description:Similar to Eukaryotic translation initiation factor 4g (Fragment). (Os07t0555200-01);Similar to Eukaryotic translation initiation factor 4g (Fragment). (Os07t0555200-02);Similar to predicted protein. (Os07t0555200-03);Similar to predicted protein. (Os07t0555200-04);Similar to predicted protein. (Os07t0555200-05) |
| Sequence | MSQRGDRGEGHARRPGRSSSFGGGHRGGGGVGGAGKGGGGSSGQPPLATNRSFRKSGNGH |
| Transcript ID | Os07t0555200-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:7:22114961:22120060:1 gene:Os07g0555200 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Rice tungro spherical virus (RTSV) resistance gene, RTSV resistance gene, eukaryotic translation initiation factor 4G description:Similar to Eukaryotic translation initiation factor 4g (Fragment). (Os07t0555200-01);Similar to Eukaryotic translation initiation factor 4g (Fragment). (Os07t0555200-02);Similar to predicted protein. (Os07t0555200-03);Similar to predicted protein. (Os07t0555200-04);Similar to predicted protein. (Os07t0555200-05) |
| Sequence | GCTTCGCCCCCACTCTTCACTCCCCTCCCCACCCCCACCCATCAATTTCTTCGTCCGTCT |