| CDS ID | Os07t0174900-00 |
| CDS Infomation | cds chromosome:IRGSP-1.0:7:3947968:3949371:-1 gene:Os07g0174900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 16, type G nsLTP 16, type G non-specific lipid transfer protein 16 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os07t0174900-00) |
| Sequence | ATGGCGCGCAATAATGGCGTCGCGGTGATGTTCGCCGCCGTGGTCGTCGTCGCCGGCGCG |
| PEP ID | Os07t0174900-00 |
| PEP Infomation | pep chromosome:IRGSP-1.0:7:3947968:3949371:-1 gene:Os07g0174900 transcript:Os07t0174900-00 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 16, type G nsLTP 16, type G non-specific lipid transfer protein 16 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os07t0174900-00) |
| Sequence | MARNNGVAVMFAAVVVVAGALVAGAAAQSGCTSEMVSLAPCLDYMQGNASRPTASCCAAL |
| Transcript ID | Os07t0174900-00 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:7:3947968:3949371:-1 gene:Os07g0174900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 16, type G nsLTP 16, type G non-specific lipid transfer protein 16 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os07t0174900-00) |
| Sequence | CACACCATCAAGCTATAATCCGATCTTAATTACATCATTAGCCAGCTAATTAAGTATATA |