| CDS ID | Os06t0705400-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:6:29807824:29808449:1 gene:Os06g0705400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:non-specific lipid transfer protein 2.6, lipid transfer protein 2.6, type 2 non-specific lipid transfer protein 6 description:Hypothetical conserved gene. (Os06t0705400-01);Similar to Nonspecific lipid-transfer protein 2P (LTP2P) (Lipid transfer protein 2 isoform 2) (LTP2-2) (7 kDa lipid transfer protein 2). (Os06t0705400-02) |
| Sequence | ATGGCGGGCATCAACCGCAAGGGCGGCGCGGCGGCGGCGTACGCGGTGGCGCTGTTGCTT |
| PEP ID | Os06t0705400-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:6:29807824:29808449:1 gene:Os06g0705400 transcript:Os06t0705400-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:non-specific lipid transfer protein 2.6, lipid transfer protein 2.6, type 2 non-specific lipid transfer protein 6 description:Hypothetical conserved gene. (Os06t0705400-01);Similar to Nonspecific lipid-transfer protein 2P (LTP2P) (Lipid transfer protein 2 isoform 2) (LTP2-2) (7 kDa lipid transfer protein 2). (Os06t0705400-02) |
| Sequence | MAGINRKGGAAAAYAVALLLAAGAADAAGCNPSALSPCMSAIMLGAAPSPGCCVQLRAQQ |
| Transcript ID | Os06t0705400-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:6:29807824:29808449:1 gene:Os06g0705400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:non-specific lipid transfer protein 2.6, lipid transfer protein 2.6, type 2 non-specific lipid transfer protein 6 description:Hypothetical conserved gene. (Os06t0705400-01);Similar to Nonspecific lipid-transfer protein 2P (LTP2P) (Lipid transfer protein 2 isoform 2) (LTP2-2) (7 kDa lipid transfer protein 2). (Os06t0705400-02) |
| Sequence | ACACGCACACTGACACACAGTCACACACCATCCCGCTCTCTCCATCGATCTCCATCACAA |