| CDS ID | Os06t0663900-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:6:27413186:27417442:1 gene:Os06g0663900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RECEPTOR-LIKE CYTOPLASMIC KINASE 212 description:Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-01);Protein kinase, core domain containing protein. (Os06t0663900-02);Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-03);Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-04) |
| Sequence | ATGACGAAACTGAAGGAGTATTTGGTGATTGAATCTGCAGAGGTCGGTAATGAAGATGGG |
| PEP ID | Os06t0663900-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:6:27413186:27417442:1 gene:Os06g0663900 transcript:Os06t0663900-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RECEPTOR-LIKE CYTOPLASMIC KINASE 212 description:Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-01);Protein kinase, core domain containing protein. (Os06t0663900-02);Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-03);Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-04) |
| Sequence | MTKLKEYLVIESAEVGNEDGRQEDLLVKEGPGEHQENTIRDSDEAKNEDCSNSGSVTEAV |
| Transcript ID | Os06t0663900-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:6:27413186:27417442:1 gene:Os06g0663900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RECEPTOR-LIKE CYTOPLASMIC KINASE 212 description:Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-01);Protein kinase, core domain containing protein. (Os06t0663900-02);Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-03);Similar to (RAP Annotation release2) Protein kinase-like domain containing protein. (Os06t0663900-04) |
| Sequence | ATTCTTCTCTTCTCTCTCAAATATTCTGTTTCTCGCATACAAGTTTGCTCCTCTTTTTTC |