| CDS ID | Os06t0499500-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:6:17586900:17590594:-1 gene:Os06g0499500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GH3-7 description:Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17). (Os06t0499500-01);Similar to GH3.17; indole-3-acetic acid amido synthetase. (Os06t0499500-02);Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17). (Os06t0499500-03) |
| Sequence | ATGGCGCTCCTGCTGCCGGAGTTCGACCCGGCGGACGTCCGCGCCGGCCGCGACCTCATC |
| PEP ID | Os06t0499500-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:6:17586900:17590594:-1 gene:Os06g0499500 transcript:Os06t0499500-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GH3-7 description:Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17). (Os06t0499500-01);Similar to GH3.17; indole-3-acetic acid amido synthetase. (Os06t0499500-02);Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17). (Os06t0499500-03) |
| Sequence | MALLLPEFDPADVRAGRDLIHRLTADAAGIQRGVLREILSRNSGTEYLRRFLGGAAGDDD |
| Transcript ID | Os06t0499500-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:6:17586900:17590594:-1 gene:Os06g0499500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GH3-7 description:Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17). (Os06t0499500-01);Similar to GH3.17; indole-3-acetic acid amido synthetase. (Os06t0499500-02);Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17). (Os06t0499500-03) |
| Sequence | ACTGTTACCAGTTGGTGTGATTCTCCAGCCGAAACTTCACCAACCAAGCAGGAATGGCGC |