| CDS ID | Os06t0225300-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:6:6484167:6488215:-1 gene:Os06g0225300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:somatic embryogenesis receptor-like kinase 3, somatic embryogenesis receptor kinase 3, SERK-like gene 6, bri1-associated receptor kinase 1 (BAK1) homologue 3, BRASSINOSTEROID INSENSITIVE1-ASSOCIATED RECEPTOR KINASE1 description:Similar to SERK1 (Fragment). (Os06t0225300-01);Similar to SERK1 (Fragment). (Os06t0225300-02) |
| Sequence | ATGGCCGCGCGGCGGCGCCTCCTCCTGCTCCTCGTCCTCCTGCTGTGCCGCCTCGCCGCC |
| PEP ID | Os06t0225300-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:6:6484167:6488215:-1 gene:Os06g0225300 transcript:Os06t0225300-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:somatic embryogenesis receptor-like kinase 3, somatic embryogenesis receptor kinase 3, SERK-like gene 6, bri1-associated receptor kinase 1 (BAK1) homologue 3, BRASSINOSTEROID INSENSITIVE1-ASSOCIATED RECEPTOR KINASE1 description:Similar to SERK1 (Fragment). (Os06t0225300-01);Similar to SERK1 (Fragment). (Os06t0225300-02) |
| Sequence | MAARRRLLLLLVLLLCRLAAVLPTSEVEALQGFMAGFAGGNAAFQSWDASAPNPCTWFHV |
| Transcript ID | Os06t0225300-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:6:6484167:6488215:-1 gene:Os06g0225300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:somatic embryogenesis receptor-like kinase 3, somatic embryogenesis receptor kinase 3, SERK-like gene 6, bri1-associated receptor kinase 1 (BAK1) homologue 3, BRASSINOSTEROID INSENSITIVE1-ASSOCIATED RECEPTOR KINASE1 description:Similar to SERK1 (Fragment). (Os06t0225300-01);Similar to SERK1 (Fragment). (Os06t0225300-02) |
| Sequence | GGAAGTGAGCCCCCGCGCCACGGCCACGCGCCGCGGGCTTCCTCCTCCTCCTCCTCCTCC |