| CDS ID | Os06t0128300-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:6:1492909:1502379:-1 gene:Os06g0128300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ABC TRANSPORTER B FAMILY MEMBER 23 description:Mitochondrial half ABC (ATP-binding cassette) transporter, Iron homeostasis, Meristem maintenance (Os06t0128300-01);Similar to STA1 (STARIK 1); ATPase, coupled to transmembrane movement of substances. (Os06t0128300-02);Similar to Mitochondrial half-ABC transporter. (Os06t0128300-03) |
| Sequence | ATGAGGCCGACCTCCCGCATACTGGCCGCGGGCCACCTCCTCCGCGGCTCACGCTCACGC |
| PEP ID | Os06t0128300-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:6:1492909:1502379:-1 gene:Os06g0128300 transcript:Os06t0128300-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ABC TRANSPORTER B FAMILY MEMBER 23 description:Mitochondrial half ABC (ATP-binding cassette) transporter, Iron homeostasis, Meristem maintenance (Os06t0128300-01);Similar to STA1 (STARIK 1); ATPase, coupled to transmembrane movement of substances. (Os06t0128300-02);Similar to Mitochondrial half-ABC transporter. (Os06t0128300-03) |
| Sequence | MRPTSRILAAGHLLRGSRSRYDPSPVAAAAPIFRRPPTVPRPLPSPLLGGFGPNCWVYPG |
| Transcript ID | Os06t0128300-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:6:1492909:1502379:-1 gene:Os06g0128300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ABC TRANSPORTER B FAMILY MEMBER 23 description:Mitochondrial half ABC (ATP-binding cassette) transporter, Iron homeostasis, Meristem maintenance (Os06t0128300-01);Similar to STA1 (STARIK 1); ATPase, coupled to transmembrane movement of substances. (Os06t0128300-02);Similar to Mitochondrial half-ABC transporter. (Os06t0128300-03) |
| Sequence | CTCTTCCACGCTTCGGCTTCCATCCAATCATCTGCATCGTCGTCGCCGGCGAGCGCCATG |