Oryza sativa| CDS ID | Os05t0595300-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:5:29656683:29660315:1 gene:Os05g0595300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CO2-Responsive CONSTANS, CONSTANSlike, and Time of Chlorophyll a/b Binding Protein1, CO<sub>2</sub>-Responsive CONSTANS, CONSTANSlike, and Time of Chlorophyll a/b Binding Protein1, nutrition response and root growth a description:NRR alternative splicing variant, Regulation of root development in response to macronutrient deficiency (Os05t0595300-01);CCT domain-containing protein, Regulator of starch synthesis, Regulation of root development in response to macronutrient deficiency (Os05t0595300-02) |
| Sequence | ATGTACGCCGCCATGTACCCGGAGACCTTCGGCTTCTCTGCTTACCCCCAGCAGCAGCAG |
| PEP ID | Os05t0595300-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:5:29656683:29660315:1 gene:Os05g0595300 transcript:Os05t0595300-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CO2-Responsive CONSTANS, CONSTANSlike, and Time of Chlorophyll a/b Binding Protein1, CO<sub>2</sub>-Responsive CONSTANS, CONSTANSlike, and Time of Chlorophyll a/b Binding Protein1, nutrition response and root growth a description:NRR alternative splicing variant, Regulation of root development in response to macronutrient deficiency (Os05t0595300-01);CCT domain-containing protein, Regulator of starch synthesis, Regulation of root development in response to macronutrient deficiency (Os05t0595300-02) |
| Sequence | MYAAMYPETFGFSAYPQQQQPPPDAASCIYTTALPLIADPPDILGNMAQPSFLSEYDLGG |
| Transcript ID | Os05t0595300-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:5:29656683:29660315:1 gene:Os05g0595300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CO2-Responsive CONSTANS, CONSTANSlike, and Time of Chlorophyll a/b Binding Protein1, CO<sub>2</sub>-Responsive CONSTANS, CONSTANSlike, and Time of Chlorophyll a/b Binding Protein1, nutrition response and root growth a description:NRR alternative splicing variant, Regulation of root development in response to macronutrient deficiency (Os05t0595300-01);CCT domain-containing protein, Regulator of starch synthesis, Regulation of root development in response to macronutrient deficiency (Os05t0595300-02) |
| Sequence | GCTTCCGCCTTGTTCAATAATCAATATACTCTTCTCCTCGATCTCTTCTCTTGTCCATCT |