| CDS ID | Os05t0558800-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:5:27794664:27796994:1 gene:Os05g0558800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:adaptor protein NINJA 1, adaptor protein NINJA 2, NOVEL INTERACTOR OF JAZ 1, NOVEL INTERACTOR OF JAZ 2 description:Protein of unknown function DUF1675 family protein. (Os05t0558800-01);Protein of unknown function DUF1675 family protein. (Os05t0558800-02);Similar to UPF0737 protein 8. (Os05t0558800-03) |
| Sequence | ATGGACGATGAGAATGGCCTTGAGCTTAGCTTGGGTCTCTCTTTGGGTGGGACATCAGGA |
| PEP ID | Os05t0558800-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:5:27794664:27796994:1 gene:Os05g0558800 transcript:Os05t0558800-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:adaptor protein NINJA 1, adaptor protein NINJA 2, NOVEL INTERACTOR OF JAZ 1, NOVEL INTERACTOR OF JAZ 2 description:Protein of unknown function DUF1675 family protein. (Os05t0558800-01);Protein of unknown function DUF1675 family protein. (Os05t0558800-02);Similar to UPF0737 protein 8. (Os05t0558800-03) |
| Sequence | MDDENGLELSLGLSLGGTSGKSKARDAPLEPKAEPQVEESSSKGVSQTPEAPFVHYYQTN |
| Transcript ID | Os05t0558800-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:5:27794664:27796994:1 gene:Os05g0558800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:adaptor protein NINJA 1, adaptor protein NINJA 2, NOVEL INTERACTOR OF JAZ 1, NOVEL INTERACTOR OF JAZ 2 description:Protein of unknown function DUF1675 family protein. (Os05t0558800-01);Protein of unknown function DUF1675 family protein. (Os05t0558800-02);Similar to UPF0737 protein 8. (Os05t0558800-03) |
| Sequence | ATTCCAACCCGCGACTGCGAGCGAGGCGAGTAGGGCGGCTTCGTCGTTCGTCCTGCTGCT |