| CDS ID | Os05t0144800-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:5:2584804:2590118:-1 gene:Os05g0144800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Xeroderma pigmentosum (XP) complementation group of protein D, XERODERMA PIGMENTOSUM D description:Similar to TFIIH basal transcription factor complex helicase subunit (EC 3.6.1.-) (DNA-repair protein complementing XP-D cells) (Xeroderma pigmentosum group D complementing protein) (CXPD) (DNA excision repair protein ERCC-2). (Os05t0144800-01) |
| Sequence | ATGAAGTTCGACCTGGAGGGCCTGACGGTGCACTTCCCGTACGCGGCGATCTACCCGGAG |
| PEP ID | Os05t0144800-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:5:2584804:2590118:-1 gene:Os05g0144800 transcript:Os05t0144800-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Xeroderma pigmentosum (XP) complementation group of protein D, XERODERMA PIGMENTOSUM D description:Similar to TFIIH basal transcription factor complex helicase subunit (EC 3.6.1.-) (DNA-repair protein complementing XP-D cells) (Xeroderma pigmentosum group D complementing protein) (CXPD) (DNA excision repair protein ERCC-2). (Os05t0144800-01) |
| Sequence | MKFDLEGLTVHFPYAAIYPEQHAYMGELKRALDARGHALLEMPTGTGKTSALISLITSYS |
| Transcript ID | Os05t0144800-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:5:2584804:2590118:-1 gene:Os05g0144800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Xeroderma pigmentosum (XP) complementation group of protein D, XERODERMA PIGMENTOSUM D description:Similar to TFIIH basal transcription factor complex helicase subunit (EC 3.6.1.-) (DNA-repair protein complementing XP-D cells) (Xeroderma pigmentosum group D complementing protein) (CXPD) (DNA excision repair protein ERCC-2). (Os05t0144800-01) |
| Sequence | ACGGGCACGGCATTGTAACGAACACCTCACGCGCACACCCTCCCCTCCCCACGGCGGCGG |