| CDS ID | Os04t0684900-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:4:34980601:34981819:1 gene:Os04g0684900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CCR4-associated factor 1B, carbon cataboliterepressor 4-associated factor 1B, CCR4-associated factor 1-5 description:Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Development and stress response (Os04t0684900-01);Component of the CCR4-NOTcomplex, Deadenylase, Component of the plant P-body, Deadenylation (poly(A) tail shortening), Development and stress response (Os04t0684900-02) |
| Sequence | ATGCCGTCAGAGTTCGTCGCCGCCAGGAAGAAGCCGCCGCCGGAGTTGTTGTTCGCCGCC |
| PEP ID | Os04t0684900-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:4:34980601:34981819:1 gene:Os04g0684900 transcript:Os04t0684900-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CCR4-associated factor 1B, carbon cataboliterepressor 4-associated factor 1B, CCR4-associated factor 1-5 description:Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Development and stress response (Os04t0684900-01);Component of the CCR4-NOTcomplex, Deadenylase, Component of the plant P-body, Deadenylation (poly(A) tail shortening), Development and stress response (Os04t0684900-02) |
| Sequence | MPSEFVAARKKPPPELLFAAGRKKQQPPPPGMAFVPSEFAAAGVGRKRQPAPPVEIRRVW |
| Transcript ID | Os04t0684900-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:4:34980601:34981819:1 gene:Os04g0684900 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CCR4-associated factor 1B, carbon cataboliterepressor 4-associated factor 1B, CCR4-associated factor 1-5 description:Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Development and stress response (Os04t0684900-01);Component of the CCR4-NOTcomplex, Deadenylase, Component of the plant P-body, Deadenylation (poly(A) tail shortening), Development and stress response (Os04t0684900-02) |
| Sequence | AAACAGGCAAACGCACTCGCATCTCCAATTCGGTCCGAATTTTTCCAAATTCCAATTGCT |