| CDS ID | Os04t0382300-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:4:18746934:18749519:-1 gene:Os04g0382300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cystathionine b-synthase domain containing protein OsCBSCBS3, CBS domain containing protein OsCBSCBS3 description:Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-01);Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-02);Similar to OSIGBa0092E09.6 protein. (Os04t0382300-03) |
| Sequence | GTTGATGCTCCAGAAGATGCTAGTTGGATTGACAAATACATTGGCATTGTGGAATTTGCT |
| PEP ID | Os04t0382300-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:4:18746934:18749519:-1 gene:Os04g0382300 transcript:Os04t0382300-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cystathionine b-synthase domain containing protein OsCBSCBS3, CBS domain containing protein OsCBSCBS3 description:Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-01);Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-02);Similar to OSIGBa0092E09.6 protein. (Os04t0382300-03) |
| Sequence | VDAPEDASWIDKYIGIVEFAGIAMWLLYQSEAAANGTAGSAVGSPVANLVSRLGSFTFRR |
| Transcript ID | Os04t0382300-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:4:18746934:18749519:-1 gene:Os04g0382300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cystathionine b-synthase domain containing protein OsCBSCBS3, CBS domain containing protein OsCBSCBS3 description:Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-01);Similar to SNF1-related protein kinase regulatory gamma subunit 1 (AKIN gamma1) (AKING1). (Os04t0382300-02);Similar to OSIGBa0092E09.6 protein. (Os04t0382300-03) |
| Sequence | GTTGATGCTCCAGAAGATGCTAGTTGGATTGACAAATACATTGGCATTGTGGAATTTGCT |