| CDS ID | Os04t0103300-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:4:226937:229776:-1 gene:Os04g0103300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Rhomboid 10, RHOMBOID 10 description:Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-01);Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-02);Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-03) |
| Sequence | ATGATGGAGAGCCAGGCGCTGCAGGACCCCGTCGCCGAGCCCCATGGAGCTGAGCCTGCC |
| PEP ID | Os04t0103300-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:4:226937:229776:-1 gene:Os04g0103300 transcript:Os04t0103300-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Rhomboid 10, RHOMBOID 10 description:Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-01);Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-02);Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-03) |
| Sequence | MMESQALQDPVAEPHGAEPAAAGAPPAVVPGKEFTRTCKGLVVVLVGGYVLLQLLPSSLD |
| Transcript ID | Os04t0103300-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:4:226937:229776:-1 gene:Os04g0103300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Rhomboid 10, RHOMBOID 10 description:Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-01);Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-02);Protein of unknown function DUF1751, integral membrane, eukaryotic domain containing protein. (Os04t0103300-03) |
| Sequence | CTGAGGAGGGAGGAGAGGAGGTTCGTGATGATGGAGAGCCAGGCGCTGCAGGACCCCGTC |