| CDS ID | Os03t0815100-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:34166100:34167521:1 gene:Os03g0815100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SNAC1: stress-responsive NAC1, stress-responsive NAC 1, stress-induced transcription factor NAC1, NAC domain protein 9, NAC domain-containing protein 2, NAC domain-containing protein 33, NAC domain-containing protein 43, NAC domain-containing protein 44 description:Similar to OsNAC6 protein. (Os03t0815100-01) |
| Sequence | ATGGGGATGGGGATGAGGAGGGAGAGGGACGCGGAGGCGGAGCTGAACCTGCCGCCGGGG |
| PEP ID | Os03t0815100-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:34166100:34167521:1 gene:Os03g0815100 transcript:Os03t0815100-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SNAC1: stress-responsive NAC1, stress-responsive NAC 1, stress-induced transcription factor NAC1, NAC domain protein 9, NAC domain-containing protein 2, NAC domain-containing protein 33, NAC domain-containing protein 43, NAC domain-containing protein 44 description:Similar to OsNAC6 protein. (Os03t0815100-01) |
| Sequence | MGMGMRRERDAEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPIIAEVDLYKFDPW |
| Transcript ID | Os03t0815100-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:34166100:34167521:1 gene:Os03g0815100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SNAC1: stress-responsive NAC1, stress-responsive NAC 1, stress-induced transcription factor NAC1, NAC domain protein 9, NAC domain-containing protein 2, NAC domain-containing protein 33, NAC domain-containing protein 43, NAC domain-containing protein 44 description:Similar to OsNAC6 protein. (Os03t0815100-01) |
| Sequence | ATTCGAGAAATCCCTCACAACCCACAACATTTTCAAACAACGCAAAGCAGTAGCAGCAGC |