| CDS ID | Os03t0793800-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:33023016:33023942:-1 gene:Os03g0793800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 7, type G nsLTP 7, type G non-specific lipid transfer protein 7 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os03t0793800-01) |
| Sequence | ATGGCGGCAGCAGGAGTGAGCGGGTTGGCGGTGGGGTGCCTCGTGGCCGCCACGGCGGCG |
| PEP ID | Os03t0793800-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:33023016:33023942:-1 gene:Os03g0793800 transcript:Os03t0793800-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 7, type G nsLTP 7, type G non-specific lipid transfer protein 7 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os03t0793800-01) |
| Sequence | MAAAGVSGLAVGCLVAATAALLVAGASAQTGCTAALINLYPCLNYISGNETSPTRTCCSQ |
| Transcript ID | Os03t0793800-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:33023016:33023942:-1 gene:Os03g0793800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GPI-anchored non-specific lipid transfer protein 7, type G nsLTP 7, type G non-specific lipid transfer protein 7 description:Plant lipid transfer protein and hydrophobic protein, helical domain containing protein. (Os03t0793800-01) |
| Sequence | ACAAACACACAAGCTAAGCAATCTGAATTAGCAAAGCATCCAGTTCTGACACTAATTTTC |