| CDS ID | Os03t0792500-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:32957958:32964489:1 gene:Os03g0792500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MATH-BTB protein 5, MDC protein with a BTB domain 5, MDC protein having BTB domain 5 description:Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-01);Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-02);Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-03) |
| Sequence | ATGGAGGATGACGACGCGGGGGGCGGAGGCGGAGGCGGCGAGGCGTCCCCGCCGCACGCG |
| PEP ID | Os03t0792500-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:32957958:32964489:1 gene:Os03g0792500 transcript:Os03t0792500-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MATH-BTB protein 5, MDC protein with a BTB domain 5, MDC protein having BTB domain 5 description:Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-01);Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-02);Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-03) |
| Sequence | MEDDDAGGGGGGGEASPPHAGSAAAMAGAGRDIAASPTSSRSVTQTVNGSHRFVIQGYSL |
| Transcript ID | Os03t0792500-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:32957958:32964489:1 gene:Os03g0792500 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MATH-BTB protein 5, MDC protein with a BTB domain 5, MDC protein having BTB domain 5 description:Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-01);Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-02);Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792500-03) |
| Sequence | AAGCAAAATCCCCATTTCCTTCTCCTCTCCAAACCCTAGCAAAGGCTATCTCTCTCTTCG |