| CDS ID | Os03t0761100-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:31472117:31474768:-1 gene:Os03g0761100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:protein phosphatase 2C34, protein phosphatase 2C 34, protein phosphatase 55, BTH-induced protein phosphatase 2C 2 description:Protein phosphatase 2C-like protein. (Os03t0761100-01);Similar to protein phosphatase 2C family protein / PP2C family protein. (Os03t0761100-02);Protein phosphatase 2C-like protein. (Os03t0761100-03) |
| Sequence | ATGTTGAGGGCGGTGGCGAGGTGCTGCGGGCACTGGCCGCCGGGGGCGGCGGCGGCGGAC |
| PEP ID | Os03t0761100-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:31472117:31474768:-1 gene:Os03g0761100 transcript:Os03t0761100-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:protein phosphatase 2C34, protein phosphatase 2C 34, protein phosphatase 55, BTH-induced protein phosphatase 2C 2 description:Protein phosphatase 2C-like protein. (Os03t0761100-01);Similar to protein phosphatase 2C family protein / PP2C family protein. (Os03t0761100-02);Protein phosphatase 2C-like protein. (Os03t0761100-03) |
| Sequence | MLRAVARCCGHWPPGAAAADGMLWQTELRPHAAGEFSMAAAQANLAMEDQAQVLASPAAT |
| Transcript ID | Os03t0761100-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:31472117:31474768:-1 gene:Os03g0761100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:protein phosphatase 2C34, protein phosphatase 2C 34, protein phosphatase 55, BTH-induced protein phosphatase 2C 2 description:Protein phosphatase 2C-like protein. (Os03t0761100-01);Similar to protein phosphatase 2C family protein / PP2C family protein. (Os03t0761100-02);Protein phosphatase 2C-like protein. (Os03t0761100-03) |
| Sequence | AAATCAAATTCCAATTCCAATTCCATTTTCTCGATCAAACACAGCACACAGGATTGGACG |