| CDS ID | Os03t0760800-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:31464821:31465623:-1 gene:Os03g0760800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GA Stimulated Rice 1, GA-stimulated transcript-related gene 1 description:A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Control of seedling growth and α-amylase expression, Cell proliferation in meristems and panicles development (Os03t0760800-01) |
| Sequence | ATGAAGCTCAACACCACCACCACCCTGGCTCTCCTCCTGCTCCTGCTCTTGGCCTCCTCT |
| PEP ID | Os03t0760800-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:31464821:31465623:-1 gene:Os03g0760800 transcript:Os03t0760800-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GA Stimulated Rice 1, GA-stimulated transcript-related gene 1 description:A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Control of seedling growth and α-amylase expression, Cell proliferation in meristems and panicles development (Os03t0760800-01) |
| Sequence | MKLNTTTTLALLLLLLLASSSLQVSMAGSDFCDGKCKVRCSKASRHDDCLKYCGVCCASC |
| Transcript ID | Os03t0760800-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:31464821:31465623:-1 gene:Os03g0760800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:GA Stimulated Rice 1, GA-stimulated transcript-related gene 1 description:A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Control of seedling growth and α-amylase expression, Cell proliferation in meristems and panicles development (Os03t0760800-01) |
| Sequence | ACTCTCCACAACACCCCAACTCTGAAGCTGCTTGCTTGGAGTCTAGGACCAGCATTCACA |