| CDS ID | Os03t0725400-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:29486077:29489817:1 gene:Os03g0725400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:OsWD40-86 description:Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-01);Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-02);Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-03) |
| Sequence | ATGGCGGCGGAGGACAACCCGGGGTACGCCCTGCGCGCGACGCTGGCGGGCCACCGCCGC |
| PEP ID | Os03t0725400-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:29486077:29489817:1 gene:Os03g0725400 transcript:Os03t0725400-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:OsWD40-86 description:Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-01);Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-02);Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-03) |
| Sequence | MAAEDNPGYALRATLAGHRRAVSAVKFSPDGRLLASASADKLLRVWSTSDLASPVAELAG |
| Transcript ID | Os03t0725400-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:29486077:29489817:1 gene:Os03g0725400 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:OsWD40-86 description:Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-01);Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-02);Similar to WD-repeat protein 5 (BMP2-induced 3-kb gene protein) (WD-repeat protein BIG-3). (Os03t0725400-03) |
| Sequence | AAACCCTTGTTCCCTTCCCCGTCTCCGGTTGGCGCGGCGCGGGGCAATGGCGGCGGAGGA |