Oryza sativa| CDS ID | Os03t0635100-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:24252686:24256939:-1 gene:Os03g0635100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:heterotrimeric G-protein gamma subunit 1, G protein gamma1 subunit, rice G protein gamma subunit 1, G protein gamma subunit 1 description:Heterotrimeric G protein gamma subunit 1, Regulation of abiotic stresses, Salinity stress tolerance (Os03t0635100-01) |
| Sequence | ATGCAGGCCGGAGGAGGAGGGGACGCCGGGGACACGCGGGGGCGGCACCGGATCCAGGCG |
| PEP ID | Os03t0635100-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:24252686:24256939:-1 gene:Os03g0635100 transcript:Os03t0635100-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:heterotrimeric G-protein gamma subunit 1, G protein gamma1 subunit, rice G protein gamma subunit 1, G protein gamma subunit 1 description:Heterotrimeric G protein gamma subunit 1, Regulation of abiotic stresses, Salinity stress tolerance (Os03t0635100-01) |
| Sequence | MQAGGGGDAGDTRGRHRIQAELKKLEQEARFLEEELEELDKTDKVSAALQELMVTAESKA |
| Transcript ID | Os03t0635100-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:24252686:24256939:-1 gene:Os03g0635100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:heterotrimeric G-protein gamma subunit 1, G protein gamma1 subunit, rice G protein gamma subunit 1, G protein gamma subunit 1 description:Heterotrimeric G protein gamma subunit 1, Regulation of abiotic stresses, Salinity stress tolerance (Os03t0635100-01) |
| Sequence | TCCACCTCCACTTCTCTCCTCTCTCGTCTTTTGCTGCTCTGCCCAACCCACCCGCACCAC |