| CDS ID | Os03t0566800-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:20492421:20496890:-1 gene:Os03g0566800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RNA helicase 34 description:DEAD box RNA helicase homologous to eukaryotic initiation factor 4AIII (eIF4AIII), Core components of the exon junction complex (EJC), Regulation of plant height, pollen, and seed development (Os03t0566800-01) |
| Sequence | ATGGCGGCGGCCACCACGTCCCGGCGCGGCCCCGGCGCCATGGACGACGAGAACCTCACC |
| PEP ID | Os03t0566800-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:20492421:20496890:-1 gene:Os03g0566800 transcript:Os03t0566800-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RNA helicase 34 description:DEAD box RNA helicase homologous to eukaryotic initiation factor 4AIII (eIF4AIII), Core components of the exon junction complex (EJC), Regulation of plant height, pollen, and seed development (Os03t0566800-01) |
| Sequence | MAAATTSRRGPGAMDDENLTFETSPGVEVISSFDQMGIREDLLRGIYAYGFEKPSAIQQR |
| Transcript ID | Os03t0566800-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:20492421:20496890:-1 gene:Os03g0566800 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:RNA helicase 34 description:DEAD box RNA helicase homologous to eukaryotic initiation factor 4AIII (eIF4AIII), Core components of the exon junction complex (EJC), Regulation of plant height, pollen, and seed development (Os03t0566800-01) |
| Sequence | ACAGGCAGGAAGTCTCCCCACCCACGACGACCACCCCCATCTCCTTCCCCTTTCTAGGGT |