| CDS ID | Os03t0356414-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:13633732:13637491:-1 gene:Os03g0356414 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:drought-induced SINA protein 1, drought induced seven in absentia (SINA) protein 1, drought induced seven in absentia protein 1 description:Similar to Ubiquitin ligase SINAT5 (EC 6.3.2.-) (Seven in absentia homolog 5). Splice isoform 2. (Os03t0356414-01) |
| Sequence | ATGGCCTCAGTTACTTATATTGATGACTCCGGTTCTGAGGTAATTGATCCTCCAAAGACT |
| PEP ID | Os03t0356414-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:13633732:13637491:-1 gene:Os03g0356414 transcript:Os03t0356414-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:drought-induced SINA protein 1, drought induced seven in absentia (SINA) protein 1, drought induced seven in absentia protein 1 description:Similar to Ubiquitin ligase SINAT5 (EC 6.3.2.-) (Seven in absentia homolog 5). Splice isoform 2. (Os03t0356414-01) |
| Sequence | MASVTYIDDSGSEVIDPPKTEVLDVTELAGDPVPHSPKPNVVVSSSVRELLECPVCLSAM |
| Transcript ID | Os03t0356414-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:13633732:13637491:-1 gene:Os03g0356414 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:drought-induced SINA protein 1, drought induced seven in absentia (SINA) protein 1, drought induced seven in absentia protein 1 description:Similar to Ubiquitin ligase SINAT5 (EC 6.3.2.-) (Seven in absentia homolog 5). Splice isoform 2. (Os03t0356414-01) |
| Sequence | AAAAAACGCGAGAAGAGAGAGAGAGAAGCTTTTAATTCGAATTCTCTCTCTCATCACGGC |