| CDS ID | Os03t0308200-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:10970819:10979238:-1 gene:Os03g0308200 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SEMI-ROLLED LEAF 2 description:Modulation of leaf rolling, Regulation of abaxial side cell differentiation, Regulation of leaf shape, male fertility and seed size (Os03t0308200-01);Similar to ATP-dependent Clp protease proteolytic subunit. (Os03t0308200-02) |
| Sequence | ATGGGTTTCATGTCAGCGAAGCTCTTTCCTTCGTGTGAGAGTATGTGCGTGTGCTGTCCA |
| PEP ID | Os03t0308200-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:10970819:10979238:-1 gene:Os03g0308200 transcript:Os03t0308200-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SEMI-ROLLED LEAF 2 description:Modulation of leaf rolling, Regulation of abaxial side cell differentiation, Regulation of leaf shape, male fertility and seed size (Os03t0308200-01);Similar to ATP-dependent Clp protease proteolytic subunit. (Os03t0308200-02) |
| Sequence | MGFMSAKLFPSCESMCVCCPALRPSSRRPVKRYKKLLAEIFPKTPDGLPNERKIMKLCEY |
| Transcript ID | Os03t0308200-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:10970819:10979238:-1 gene:Os03g0308200 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:SEMI-ROLLED LEAF 2 description:Modulation of leaf rolling, Regulation of abaxial side cell differentiation, Regulation of leaf shape, male fertility and seed size (Os03t0308200-01);Similar to ATP-dependent Clp protease proteolytic subunit. (Os03t0308200-02) |
| Sequence | GAGACGGGTGGTGTGTGTGGAAAGCGCGGGGCGGGGCAGGGGCAAAGGCAAAGAAAAAGG |