| CDS ID | Os03t0259300-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:8398817:8405867:1 gene:Os03g0259300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:a homologue of yeast Hrd3/mammalian SEL1L description:Homologue of yeast Hrd3/mammalian SEL1L, ER-resident type I membrane protein, Polyubiquitination of unfolded proteins, Quality control of endoplasmic reticulum-derived protein bodies in rice endosperm (Os03t0259300-01);Non-protein coding transcript. (Os03t0259300-02) |
| Sequence | ATGCAGAACAGGCGGCGATCTCGTCCGGTGGTACCTACTCCGATGGCTCGCGTCCGCCAC |
| PEP ID | Os03t0259300-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:8398817:8405867:1 gene:Os03g0259300 transcript:Os03t0259300-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:a homologue of yeast Hrd3/mammalian SEL1L description:Homologue of yeast Hrd3/mammalian SEL1L, ER-resident type I membrane protein, Polyubiquitination of unfolded proteins, Quality control of endoplasmic reticulum-derived protein bodies in rice endosperm (Os03t0259300-01);Non-protein coding transcript. (Os03t0259300-02) |
| Sequence | MQNRRRSRPVVPTPMARVRHRHLLLLVAAVAAAASALLPCASAVRPFVLVLSRDDFLKDT |
| Transcript ID | Os03t0259300-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:8398817:8405867:1 gene:Os03g0259300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:a homologue of yeast Hrd3/mammalian SEL1L description:Homologue of yeast Hrd3/mammalian SEL1L, ER-resident type I membrane protein, Polyubiquitination of unfolded proteins, Quality control of endoplasmic reticulum-derived protein bodies in rice endosperm (Os03t0259300-01);Non-protein coding transcript. (Os03t0259300-02) |
| Sequence | GTCGATGCAGAACAGGCGGCGATCTCGTCCGGTGGTACCTACTCCGATGGCTCGCGTCCG |