| CDS ID | Os03t0243300-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:7579448:7583738:-1 gene:Os03g0243300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Subunit 5 a, 26S proteasome subunit 5a, 19S regulatory particle non-ATPase subunit 10, RP non-ATPase 10, Regulatory Particle Non-ATPase 10 description:Similar to 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Multiubiquitin chain binding protein). (Os03t0243300-01) |
| Sequence | ATGGTGCTCGAGGCGACGATGATCTGCATAGACAACTCGGAGTGGATGCGGAACGGCGAC |
| PEP ID | Os03t0243300-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:7579448:7583738:-1 gene:Os03g0243300 transcript:Os03t0243300-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Subunit 5 a, 26S proteasome subunit 5a, 19S regulatory particle non-ATPase subunit 10, RP non-ATPase 10, Regulatory Particle Non-ATPase 10 description:Similar to 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Multiubiquitin chain binding protein). (Os03t0243300-01) |
| Sequence | MVLEATMICIDNSEWMRNGDYSPSRFQAQADAVNLICGAKTQSNPENTVGVMTMAGKGVR |
| Transcript ID | Os03t0243300-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:7579448:7583738:-1 gene:Os03g0243300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Subunit 5 a, 26S proteasome subunit 5a, 19S regulatory particle non-ATPase subunit 10, RP non-ATPase 10, Regulatory Particle Non-ATPase 10 description:Similar to 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit S5A) (Multiubiquitin chain binding protein). (Os03t0243300-01) |
| Sequence | CCCGTATCATCTTGCTCCCCAAACCAAGCCAACCCCCTCGACGGCCGGAACACATCGGGG |