| CDS ID | Os03t0172000-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:3860925:3864548:1 gene:Os03g0172000 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MODIFIER OF SNC1, 3/SUPPRESSOR OF AUXIN RESISTANCE 3, MODIFIER OF SNC1, 3, SUPPRESSOR OF AUXIN RESISTANCE 3, Nucleoporin Autopeptidase 1, nucleoporin 96 description:Peptidase S59, nucleoporin family protein. (Os03t0172000-01);Similar to predicted protein. (Os03t0172000-02) |
| Sequence | GGTCTATCTTCTGTTATTCACATAGAGAAAGTTGCAGGCGACAAAGTTGTACGTGATGAG |
| PEP ID | Os03t0172000-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:3860925:3864548:1 gene:Os03g0172000 transcript:Os03t0172000-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MODIFIER OF SNC1, 3/SUPPRESSOR OF AUXIN RESISTANCE 3, MODIFIER OF SNC1, 3, SUPPRESSOR OF AUXIN RESISTANCE 3, Nucleoporin Autopeptidase 1, nucleoporin 96 description:Peptidase S59, nucleoporin family protein. (Os03t0172000-01);Similar to predicted protein. (Os03t0172000-02) |
| Sequence | GLSSVIHIEKVAGDKVVRDEKNKIKEELTDLCFSDPLDLHRRLHHEYLETESDLFKLKLQ |
| Transcript ID | Os03t0172000-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:3860925:3864548:1 gene:Os03g0172000 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:MODIFIER OF SNC1, 3/SUPPRESSOR OF AUXIN RESISTANCE 3, MODIFIER OF SNC1, 3, SUPPRESSOR OF AUXIN RESISTANCE 3, Nucleoporin Autopeptidase 1, nucleoporin 96 description:Peptidase S59, nucleoporin family protein. (Os03t0172000-01);Similar to predicted protein. (Os03t0172000-02) |
| Sequence | TGGTCTATCTTCTGTTATTCACATAGAGAAAGTTGCAGGCGACAAAGTTGTACGTGATGA |