| CDS ID | Os03t0171600-03 |
| CDS Infomation | cds chromosome:IRGSP-1.0:3:3834959:3836735:1 gene:Os03g0171600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F-Box Protein 12, F-box protein 130, F-box protein containing kelch motif 12 description:F-box protein containing a Kelch repeat motif, Reguration of leaf senescence, seed size and grain number (Os03t0171600-01);Kelch-type beta propeller domain containing protein. (Os03t0171600-02);Similar to kelch motif family protein. (Os03t0171600-03) |
| Sequence | GCGTACCTCTCCCACGAGGTGCTCAACGGCAAGCGCCCGGCGCCGGAGGATGCGGAAGCC |
| PEP ID | Os03t0171600-03 |
| PEP Infomation | pep chromosome:IRGSP-1.0:3:3834959:3836735:1 gene:Os03g0171600 transcript:Os03t0171600-03 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F-Box Protein 12, F-box protein 130, F-box protein containing kelch motif 12 description:F-box protein containing a Kelch repeat motif, Reguration of leaf senescence, seed size and grain number (Os03t0171600-01);Kelch-type beta propeller domain containing protein. (Os03t0171600-02);Similar to kelch motif family protein. (Os03t0171600-03) |
| Sequence | AYLSHEVLNGKRPAPEDAEAEDMDEVDFGGGKRSKPPSPQPHTPDISEGHGSSRHVAASG |
| Transcript ID | Os03t0171600-03 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:3:3834959:3836735:1 gene:Os03g0171600 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F-Box Protein 12, F-box protein 130, F-box protein containing kelch motif 12 description:F-box protein containing a Kelch repeat motif, Reguration of leaf senescence, seed size and grain number (Os03t0171600-01);Kelch-type beta propeller domain containing protein. (Os03t0171600-02);Similar to kelch motif family protein. (Os03t0171600-03) |
| Sequence | GGGCGTACCTCTCCCACGAGGTGCTCAACGGCAAGCGCCCGGCGCCGGAGGATGCGGAAG |