| CDS ID | Os02t0819100-01 |
| CDS Infomation | cds chromosome:IRGSP-1.0:2:35155661:35158722:1 gene:Os02g0819100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DHHC-TYPE ZINC FINGER PROTEIN 1 description:DHHC-type zinc finger protein, Regulation of plant architecture by altering the tiller (Os02t0819100-01);DHHC-type zinc finger protein, Regulation of plant architecture by altering the tiller (Os02t0819100-02) |
| Sequence | ATGGCGCGGAGGAGGGGAAGCGCGGCGGCGGCCGCGGCCTCGCCGGCCGTGGTCGGGGCG |
| PEP ID | Os02t0819100-01 |
| PEP Infomation | pep chromosome:IRGSP-1.0:2:35155661:35158722:1 gene:Os02g0819100 transcript:Os02t0819100-01 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DHHC-TYPE ZINC FINGER PROTEIN 1 description:DHHC-type zinc finger protein, Regulation of plant architecture by altering the tiller (Os02t0819100-01);DHHC-type zinc finger protein, Regulation of plant architecture by altering the tiller (Os02t0819100-02) |
| Sequence | MARRRGSAAAAAASPAVVGAVSVLALVYYSTVFVFLDHWLGLGNAAGAAHAAAFSLVVAA |
| Transcript ID | Os02t0819100-01 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:2:35155661:35158722:1 gene:Os02g0819100 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:DHHC-TYPE ZINC FINGER PROTEIN 1 description:DHHC-type zinc finger protein, Regulation of plant architecture by altering the tiller (Os02t0819100-01);DHHC-type zinc finger protein, Regulation of plant architecture by altering the tiller (Os02t0819100-02) |
| Sequence | GAAGTGAGGCCGGAGAGCTCGGAGAAGGGCCCGACGAAGCGCAGGTGGGGATCACCTCGC |