| CDS ID | Os02t0796300-02 |
| CDS Infomation | cds chromosome:IRGSP-1.0:2:33854237:33855650:1 gene:Os02g0796300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CCR4-associated factor 1H, carbon cataboliterepressor 4-associated factor 1H, CCR4-associated factor 1-1 description:Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Heat stress response (Os02t0796300-01);Similar to CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1). (Os02t0796300-02) |
| Sequence | ATGCCAATGTCGGATCCCACGGCGGCGGTCATCCCCAAGCCGGGGGGCATCGGCGTCGGC |
| PEP ID | Os02t0796300-02 |
| PEP Infomation | pep chromosome:IRGSP-1.0:2:33854237:33855650:1 gene:Os02g0796300 transcript:Os02t0796300-02 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CCR4-associated factor 1H, carbon cataboliterepressor 4-associated factor 1H, CCR4-associated factor 1-1 description:Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Heat stress response (Os02t0796300-01);Similar to CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1). (Os02t0796300-02) |
| Sequence | MPMSDPTAAVIPKPGGIGVGGGGGDDEEPVEIREVWADNLEEEFALIRDVVDEFPFVAMD |
| Transcript ID | Os02t0796300-02 |
| Transcript Infomation | cdna chromosome:IRGSP-1.0:2:33854237:33855650:1 gene:Os02g0796300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CCR4-associated factor 1H, carbon cataboliterepressor 4-associated factor 1H, CCR4-associated factor 1-1 description:Component of the CCR4-NOTcomplex, Deadenylase, Deadenylation (poly(A) tail shortening), Heat stress response (Os02t0796300-01);Similar to CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1). (Os02t0796300-02) |
| Sequence | GTTTCGATTCGTCTCGCCCAAATCTTCAAATCCAAATCCGCAGCGGAGGCGGCCGGGGCG |